PDB entry 1dj9

View 1dj9 on RCSB PDB site
Description: crystal structure of 8-amino-7-oxonanoate synthase (or 7-keto-8aminipelargonate or kapa synthase) complexed with plp and the product 8(s)-amino-7-oxonanonoate (or kapa). the enzyme of biotin biosynthetic pathway.
Class: transferase
Keywords: 8-amino-7-oxononanoate synthase, biotin, pyridoxal-5'-phosphate, transferase
Deposited on 1999-12-02, released 2000-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-amino-7-oxononanoate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dj9a_
  • Heterogens: SO4, MG, KAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dj9A (A:)
    mswqekinaaldargaadalrrrypvaqgagrwlvaddrqylnfssndylglshhpqiir
    awqqgaeqfgigsggsghvsgysvvhqaleeelaewlgysrallfisgfaanqaviaamm
    akedriaadrlshaslleaaslspsqlrrfahndvthlarllaspcpgqqmvvtegvfsm
    dgdsaplaeiqqvtqqhngwlmvddahgtgvigeqgrgscwlqkvkpellvvtfgkgfgv
    sgaavlcsstvadyllqfarhliystsmppaqaqalraslavirsdegdarreklaalit
    rfragvqdlpftladscsaiqplivgdnsralqlaeklrqqgcwvtgirpptvpagiarl
    rltltaahemqdidrllevlhgng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dj9A (A:)
    swqekinaaldargaadalrrrypvaqgagrwlvaddrqylnfssndylglshhpqiira
    wqqgaeqfgigsggsghvsgysvvhqaleeelaewlgysrallfisgfaanqaviaamma
    kedriaadrlshaslleaaslspsqlrrfahndvthlarllaspcpgqqmvvtegvfsmd
    gdsaplaeiqqvtqqhngwlmvddahgtgvigeqgrgscwlqkvkpellvvtfgkgfgvs
    gaavlcsstvadyllqfarhliystsmppaqaqalraslavirsdegdarreklaalitr
    fragvqdlpftladscsaiqplivgdnsralqlaeklrqqgcwvtgirpptvpagiarlr
    ltltaahemqdidrllevlhgng