PDB entry 1dj7

View 1dj7 on RCSB PDB site
Description: crystal structure of ferredoxin thioredoxin reductase
Class: electron transport
Keywords: 4fe-4s cluster binding fold with cxcx16cxcx8cxc binding motif, electron transport
Deposited on 1999-12-02, released 2000-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin thioredoxin reductase: catalytic chain
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dj7a_
  • Chain 'B':
    Compound: ferredoxin thioredoxin reductase: variable chain
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dj7b_
  • Heterogens: SF4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dj7A (A:)
    tssdtqnnktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhy
    edkeaevkntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkasma
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dj7A (A:)
    nnktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeae
    vkntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dj7B (B:)
    mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
    fkahfrpdevtlied
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dj7B (B:)
    mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
    fkahfrpdevtli