PDB entry 1dj5

View 1dj5 on RCSB PDB site
Description: crystal structure of r48a mutant of cytochrome c peroxidase with n-hydroxyguanidine bound
Class: oxidoreductase
Keywords: heme enzyme, cavity mutant, oxidoreductase
Deposited on 1999-12-01, released 1999-12-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-290)
      • engineered mutation (44)
    Domains in SCOPe 2.08: d1dj5a_
  • Heterogens: HEM, HGU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dj5A (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvalawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl