PDB entry 1dj3

View 1dj3 on RCSB PDB site
Description: structures of adenylosuccinate synthetase from triticum aestivum and arabidopsis thaliana
Class: ligase
Keywords: GDP, ligase
Deposited on 1999-12-01, released 2000-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylosuccinate synthetase
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24396 (Start-441)
      • conflict (18)
      • conflict (208)
    Domains in SCOPe 2.07: d1dj3a_
  • Chain 'B':
    Compound: adenylosuccinate synthetase
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24396 (Start-441)
      • conflict (18)
      • conflict (208)
    Domains in SCOPe 2.07: d1dj3b_
  • Heterogens: GDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dj3A (A:)
    salaveadpaadrvsslsnvsgvlgsqwgdegkgklvdvlaprfdivarcqgganaghti
    ynsegkkfalhlvpsgilhegtlcvvgngavihvpgffgeidglqsngvscdgrilvsdr
    ahllfdlhqtvdglreaelansfigttkrgigpcysskvtrnglrvcdlrhmdtfgdkld
    vlfedaaarfegfkyskgmlkeeverykkfaerlepfiadtvhvlnesirqkkkilvegg
    qatmldidfgtypfvtssspsaggictglgiaprvigdligvvkayttrvgsgpfptell
    geegdvlrkagmefgtttgrprrcgwldivalkyccdingfsslnltkldvlsglpeikl
    gvsynqmdgeklqsfpgdldtleqvqvnyevlpgwdsdissvrsyselpqaarryverie
    elagvpvhyigvgpgrdaliyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dj3A (A:)
    adrvsslsnvsgvlgsqwgdegkgklvdvlaprfdivarcqgganaghtiynsegkkfal
    hlvpsgilhegtlcvvgngavihvpgffgeidglqsngvscdgrilvsdrahllfdlhqt
    vdglreaelansfigttkrgigpcysskvtrnglrvcdlrhmdtfgdkldvlfedaaarf
    egfkyskgmlkeeverykkfaerlepfiadtvhvlnesirqkkkilveggqatmldidfg
    typfvtssspsaggictglgiaprvigdligvvkayttrvgsgpfptellgeegdvlrka
    gmefgtttgrprrcgwldivalkyccdingfsslnltkldvlsglpeiklgvsynqmdge
    klqsfpgdldtleqvqvnyevlpgwdsdissvrsyselpqaarryverieelagvpvhyi
    gvgpgrdaliyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dj3B (B:)
    salaveadpaadrvsslsnvsgvlgsqwgdegkgklvdvlaprfdivarcqgganaghti
    ynsegkkfalhlvpsgilhegtlcvvgngavihvpgffgeidglqsngvscdgrilvsdr
    ahllfdlhqtvdglreaelansfigttkrgigpcysskvtrnglrvcdlrhmdtfgdkld
    vlfedaaarfegfkyskgmlkeeverykkfaerlepfiadtvhvlnesirqkkkilvegg
    qatmldidfgtypfvtssspsaggictglgiaprvigdligvvkayttrvgsgpfptell
    geegdvlrkagmefgtttgrprrcgwldivalkyccdingfsslnltkldvlsglpeikl
    gvsynqmdgeklqsfpgdldtleqvqvnyevlpgwdsdissvrsyselpqaarryverie
    elagvpvhyigvgpgrdaliyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dj3B (B:)
    adrvsslsnvsgvlgsqwgdegkgklvdvlaprfdivarcqgganaghtiynsegkkfal
    hlvpsgilhegtlcvvgngavihvpgffgeidglqsngvscdgrilvsdrahllfdlhqt
    vdglreaelansfigttkrgigpcysskvtrnglrvcdlrhmdtfgdkldvlfedaaarf
    egfkyskgmlkeeverykkfaerlepfiadtvhvlnesirqkkkilveggqatmldidfg
    typfvtssspsaggictglgiaprvigdligvvkayttrvgsgpfptellgeegdvlrka
    gmefgtttgrprrcgwldivalkyccdingfsslnltkldvlsglpeiklgvsynqmdge
    klqsfpgdldtleqvqvnyevlpgwdsdissvrsyselpqaarryverieelagvpvhyi
    gvgpgrdaliyk