PDB entry 1dj2

View 1dj2 on RCSB PDB site
Description: structures of adenylosuccinate synthetase from triticum aestivum and arabidopsis thaliana
Class: ligase
Keywords: GDP, ligase
Deposited on 1999-12-01, released 2000-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylosuccinate synthetase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dj2a_
  • Chain 'B':
    Compound: adenylosuccinate synthetase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dj2b_
  • Heterogens: GDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dj2A (A:)
    svaadsaateslgrigslsqvsgvlgcqwgdegkgklvdilaqhfdivarcqgganaght
    iynsegkkfalhlvpsgilnedttcvigngvvvhlpglfkeidglesngvsckgrilvsd
    rahllfdfhqevdglreselaksfigttkrgigpaysskvirngirvgdlrhmdtlpqkl
    dlllsdaaarfqgfkytpemlreeveaykryadrlepyitdtvhfindsisqkkkvlveg
    gqatmldidfgtypfvtssspsaggictglgiapsvvgdligvvkayttrvgsgpfpten
    lgtggdllrlagqefgtttgrprrcgwldivalkfscqingfaslnltkldvlsdlneiq
    lgvaykrsdgtpvksfpgdlrlleelhveyevlpgwksdissvrnysdlpkaaqqyveri
    eelvgvpihyigigpgrdaliyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dj2A (A:)
    igslsqvsgvlgcqwgdegkgklvdilaqhfdivarcqgganaghtiynsegkkfalhlv
    psgilnedttcvigngvvvhlpglfkeidglesngvsckgrilvsdrahllfdfhqevdg
    lreselaksfigttkrgigpaysskvirngirvgdlrhmdtlpqkldlllsdaaarfqgf
    kytpemlreeveaykryadrlepyitdtvhfindsisqkkkvlveggqatmldidfgtyp
    fvtssspsaggictglgiapsvvgdligvvkayttrvgsgpfptenlgtggdllrlagqe
    fgtttgrprrcgwldivalkfscqingfaslnltkldvlsdlneiqlgvaykrsdgtpvk
    sfpgdlrlleelhveyevlpgwksdissvrnysdlpkaaqqyverieelvgvpihyigig
    pgrdaliyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dj2B (B:)
    svaadsaateslgrigslsqvsgvlgcqwgdegkgklvdilaqhfdivarcqgganaght
    iynsegkkfalhlvpsgilnedttcvigngvvvhlpglfkeidglesngvsckgrilvsd
    rahllfdfhqevdglreselaksfigttkrgigpaysskvirngirvgdlrhmdtlpqkl
    dlllsdaaarfqgfkytpemlreeveaykryadrlepyitdtvhfindsisqkkkvlveg
    gqatmldidfgtypfvtssspsaggictglgiapsvvgdligvvkayttrvgsgpfpten
    lgtggdllrlagqefgtttgrprrcgwldivalkfscqingfaslnltkldvlsdlneiq
    lgvaykrsdgtpvksfpgdlrlleelhveyevlpgwksdissvrnysdlpkaaqqyveri
    eelvgvpihyigigpgrdaliyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dj2B (B:)
    igslsqvsgvlgcqwgdegkgklvdilaqhfdivarcqgganaghtiynsegkkfalhlv
    psgilnedttcvigngvvvhlpglfkeidglesngvsckgrilvsdrahllfdfhqevdg
    lreselaksfigttkrgigpaysskvirngirvgdlrhmdtlpqkldlllsdaaarfqgf
    kytpemlreeveaykryadrlepyitdtvhfindsisqkkkvlveggqatmldidfgtyp
    fvtssspsaggictglgiapsvvgdligvvkayttrvgsgpfptenlgtggdllrlagqe
    fgtttgrprrcgwldivalkfscqingfaslnltkldvlsdlneiqlgvaykrsdgtpvk
    sfpgdlrlleelhveyevlpgwksdissvrnysdlpkaaqqyverieelvgvpihyigig
    pgrdaliyk