PDB entry 1dj0

View 1dj0 on RCSB PDB site
Description: the crystal structure of e. coli pseudouridine synthase i at 1.5 angstrom resolution
Deposited on 1999-11-30, released 2000-05-31
The last revision prior to the SCOP 1.67 freeze date was dated 2000-05-31, with a file datestamp of 2000-05-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.162
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1dj0a_
  • Chain 'B':
    Domains in SCOP 1.67: d1dj0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dj0A (A:)
    ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
    gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
    lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
    gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
    lvavdypdrydlpkppmgplflad
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dj0B (B:)
    ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
    gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
    lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
    gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
    lvavdypdrydlpkppmgplflad