PDB entry 1dj0

View 1dj0 on RCSB PDB site
Description: the crystal structure of e. coli pseudouridine synthase I at 1.5 angstrom resolution
Class: lyase
Keywords: alpha/beta fold, RNA-binding motif, RNA-modifying enzyme, lyase
Deposited on 1999-11-30, released 2000-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.162
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudouridine synthase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dj0a_
  • Chain 'B':
    Compound: pseudouridine synthase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dj0b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dj0A (A:)
    ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
    gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
    lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
    gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
    lvavdypdrydlpkppmgplflad
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dj0B (B:)
    ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
    gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
    lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
    gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
    lvavdypdrydlpkppmgplflad