PDB entry 1diz

View 1diz on RCSB PDB site
Description: crystal structure of e. coli 3-methyladenine DNA glycosylase (alka) complexed with DNA
Class: hydrolase/DNA
Keywords: 3-methyladenine DNA glycosylase, alka, helix-hairpin-helix, protein-DNA complex, 1-azaribose, hydrolase-DNA complex
Deposited on 1999-11-30, released 2000-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-methyladenine DNA glycosylase II
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1diza1, d1diza2
  • Chain 'B':
    Compound: 3-methyladenine DNA glycosylase II
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dizb1, d1dizb2
  • Chain 'C':
    Compound: DNA (5'-d(*gp*ap*cp*ap*tp*gp*ap*(nri)p*tp*gp*cp*cp*t)-3')
    Species: Escherichia coli, synthetic [TaxId:562]
  • Chain 'D':
    Compound: DNA (5'-d(*gp*gp*cp*ap*ap*tp*cp*ap*tp*gp*tp*cp*a)-3')
    Species: Escherichia coli, synthetic [TaxId:562]
  • Chain 'E':
    Compound: DNA (5'-d(*gp*ap*cp*ap*tp*gp*ap*(nri)p*tp*gp*cp*cp*t)-3')
    Species: Escherichia coli, synthetic [TaxId:562]
  • Chain 'F':
    Compound: DNA (5'-d(*gp*gp*cp*ap*ap*tp*cp*ap*tp*gp*tp*cp*a)-3')
    Species: Escherichia coli, synthetic [TaxId:562]
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dizA (A:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dizB (B:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.