PDB entry 1dix

View 1dix on RCSB PDB site
Description: crystal structure of rnase le
Deposited on 1999-11-30, released 2000-09-06
The last revision prior to the SCOP 1.67 freeze date was dated 2000-09-06, with a file datestamp of 2000-09-06.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.219
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1dixa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dixA (A:)
    asgskdfdffyfvqqwpgsycdtkqsccypttgkpaadfgihglwpnnndgtypsncdpn
    spydqsqisdlissmqqnwptlacpsgsgstfwshewekhgtcaesvltnqhayfkkald
    lknqidllsilqgadihpdgesydlvnirnaiksaigytpwiqcnvdqsgnsqlyqvyic
    vdgsgssliecpifpggkcgtsiefptf