PDB entry 1dix

View 1dix on RCSB PDB site
Description: crystal structure of RNAse le
Class: hydrolase
Keywords: alpha plus beta, hydrolase
Deposited on 1999-11-30, released 2000-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: extracellular ribonuclease le
    Species: Solanum lycopersicum [TaxId:4081]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80022 (4-207)
      • cloning artifact (4-6)
    Domains in SCOPe 2.08: d1dixa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dixA (A:)
asgskdfdffyfvqqwpgsycdtkqsccypttgkpaadfgihglwpnnndgtypsncdpn
spydqsqisdlissmqqnwptlacpsgsgstfwshewekhgtcaesvltnqhayfkkald
lknqidllsilqgadihpdgesydlvnirnaiksaigytpwiqcnvdqsgnsqlyqvyic
vdgsgssliecpifpggkcgtsiefptf