PDB entry 1diw

View 1diw on RCSB PDB site
Description: the hc fragment of tetanus toxin complexed with galactose
Class: toxin
Keywords: beta trefoil, jelly-roll, toxin
Deposited on 1999-11-30, released 2000-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetanus toxin hc
    Species: Clostridium tetani [TaxId:1513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04958 (0-440)
      • conflict (55)
    Domains in SCOPe 2.07: d1diwa1, d1diwa2
  • Heterogens: GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1diwA (A:)
    edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnneesevi
    vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
    lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
    saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsylsitfl
    rdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrlynglk
    fiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgynapgi
    plykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwyfnhl
    kdkilgcdwyfvptdegwtnd