PDB entry 1dis

View 1dis on RCSB PDB site
Description: dihydrofolate reductase (e.c.1.5.1.3) complex with brodimoprim-4,6-dicarboxylate
Class: oxido-reductase
Keywords: inhibitor/enzyme complex, oxido-reductase
Deposited on 1995-08-01, released 1995-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1disa_
  • Heterogens: BDM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1disA (A:)
    taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
    vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
    sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka