PDB entry 1dio

View 1dio on RCSB PDB site
Description: diol dehydratase-cyanocobalamin complex from klebsiella oxytoca
Deposited on 1999-01-27, released 2000-01-30
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-30, with a file datestamp of 2000-01-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dioa_
  • Chain 'B':
    Domains in SCOP 1.55: d1diob_
  • Chain 'E':
    Domains in SCOP 1.55: d1dioe_
  • Chain 'G':
    Domains in SCOP 1.55: d1diog_
  • Chain 'L':
    Domains in SCOP 1.55: d1diol_
  • Chain 'M':
    Domains in SCOP 1.55: d1diom_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dioA (A:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dioB (B:)
    gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
    rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
    rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dioE (E:)
    gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi
    rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety
    rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrval
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dioG (G:)
    sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
    grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
    reaatlyverkklkgdd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dioL (L:)
    mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
    lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
    nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
    fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
    skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
    scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
    ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
    avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
    gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
    iknipgaldpn
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dioM (M:)
    sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
    grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
    reaatlyverkklkgdd