PDB entry 1din

View 1din on RCSB PDB site
Description: dienelactone hydrolase at 2.8 angstroms
Class: hydrolytic enzyme
Keywords: dienelactone hydrolase, aromatic hydrocarbon catabolism, serine esterase, carboxymethylenebutenolidase, hydrolytic enzyme
Deposited on 1996-03-14, released 1996-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.15
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dienelactone hydrolase
    Species: Pseudomonas knackmussii [TaxId:65741]
    Gene: CLC D
    Database cross-references and differences (RAF-indexed):
    • PIR S02022 (0-End)
      • microheterogeneity (122)
    Domains in SCOPe 2.07: d1dina_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dinA (A:)
    mltegisiqsydghtfgalvgspakapapviviaqeifgvnafmretvswlvdqgyaavc
    pdlyarqapgtaldpqderqreqayklwqafdmeagvgdleaairyarhqpysngkvglv
    gyclggalaflvaakgyvdravgyygvglekqlnkvpevkhpalfhmggqdhfvpapsrq
    litegfganpllqvhwyeeaghsfartsssgyvasaaalanertldflaplqskkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dinA (A:)
    mltegisiqsydghtfgalvgspakapapviviaqeifgvnafmretvswlvdqgyaavc
    pdlyarqapgtaldpqderqreqayklwqafdmeagvgdleaairyarhqpysngkvglv
    gyclggalaflvaakgyvdravgyygvglekqlnkvpevkhpalfhmggqdhfvpapsrq
    litegfganpllqvhwyeeaghsfartsssgyvasaaalanertldflaplqs