PDB entry 1dim

View 1dim on RCSB PDB site
Description: sialidase from salmonella typhimurium complexed with epana inhibitor
Deposited on 1996-04-23, released 1996-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1dim__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dim_ (-)
    tveksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntas
    dqsfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkw
    nnndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsg
    lqlndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnasl
    vnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaq
    nknndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvye
    angsiefqdlsrhlpviksyn