PDB entry 1dim

View 1dim on RCSB PDB site
Description: sialidase from salmonella typhimurium complexed with epana inhibitor
Class: glycosidase
Keywords: glycosidase, hydrolase
Deposited on 1996-04-23, released 1996-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: NANH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29768 (0-380)
      • conflict (327)
    Domains in SCOPe 2.08: d1dima_
  • Heterogens: K, EQP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dimA (A:)
    tveksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntas
    dqsfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkw
    nnndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsg
    lqlndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnasl
    vnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaq
    nknndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvye
    angsiefqdlsrhlpviksyn