PDB entry 1dil

View 1dil on RCSB PDB site
Description: sialidase from salmonella typhimurium complexed with apana and epana inhibitors
Class: glycosidase
Keywords: glycosidase, hydrolase
Deposited on 1996-04-23, released 1996-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 1996-12-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: SALMONELLA TYPHIMURIUM
    Gene: NANH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29768 (0-380)
      • conflict (327)
    Domains in SCOP 1.75: d1dila_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dilA (A:)
    tveksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntas
    dqsfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkw
    nnndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsg
    lqlndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnasl
    vnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaq
    nknndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvye
    angsiefqdlsrhlpviksyn