PDB entry 1dik

View 1dik on RCSB PDB site
Description: pyruvate phosphate dikinase
Class: phosphotransferase
Keywords: transferase, kinase, phosphotransferase
Deposited on 1995-12-06, released 1996-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate phosphate dikinase
    Species: Clostridium symbiosum [TaxId:1512]
    Gene: PPDK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22983 (1-873)
      • conflict (93)
    Domains in SCOPe 2.06: d1dika1, d1dika2, d1dika3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dikA (A:)
    makwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqe
    iqdqifeaitwleelngkkfgdtedpllvsvrsaarasmpgmmdtilnlglndvavegfa
    kktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkela
    ekfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvq
    tmvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpd
    cykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmit
    eeeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahek
    gervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineea
    ktfelgghtfaegdyisldgstgkiykgdietqeasvsgsferimvwadkfrtlkvrtna
    dtpedtlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkg
    dfkamykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnp
    mmghrgcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdv
    vvevaeqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrd
    dagkfldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpss
    vefchkvglnyvscspfrvpiarlaaaqaalnnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dikA (A:)
    akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsaarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkiietqeasvsgsferimvwadkfrtlkvrtnadtped
    tlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgdfkam
    ykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpmmghr
    gcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvvveva
    eqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrddagkf
    ldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssvefch
    kvglnyvscspfrvpiarlaaaqaalnnk