PDB entry 1dii

View 1dii on RCSB PDB site
Description: crystal structure of p-cresol methylhydroxylase at 2.5 a resolution
Deposited on 1999-11-29, released 1999-12-08
The last revision prior to the SCOP 1.57 freeze date was dated 2000-01-26, with a file datestamp of 2000-01-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.172
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1diiA (A:)
    avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
    veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
    lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
    vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkppvfk
    pfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepghtpd
    svikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdtqpfk
    yraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygldyva
    efivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdrvaqs
    ygpvkrklehaikravdpnnilapgrsgidlnndf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1diiB (B:)
    avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
    veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
    lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
    vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkppvfk
    pfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepghtpd
    svikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdtqpfk
    yraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygldyva
    efivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdrvaqs
    ygpvkrklehaikravdpnnilapgrsgidlnndf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1diiC (C:)
    sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
    sltqvaeylsslp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1diiD (D:)
    sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
    sltqvaeylsslp