PDB entry 1dig

View 1dig on RCSB PDB site
Description: human methylenetetrahydrofolate dehydrogenase / cyclohydrolase complexed with nadp and inhibitor ly374571
Deposited on 1999-11-29, released 2000-07-05
The last revision prior to the SCOP 1.69 freeze date was dated 2000-07-05, with a file datestamp of 2000-07-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1digA (A:)
    mapaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaa
    eeigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiap
    ekdvdgltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgap
    mhdlllwnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginy
    vpddkkpngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrflekfkp
    gkwmiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1digA (A:)
    apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
    eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
    kdvdgltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapm
    hdlllwnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyk
    vvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1digB (B:)
    mapaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaa
    eeigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiap
    ekdvdgltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgap
    mhdlllwnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginy
    vpddkkpngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrflekfkp
    gkwmiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1digB (B:)
    apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
    eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
    kdvdgltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapm
    hdlllwnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyv
    pddkkpngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle