PDB entry 1dig

View 1dig on RCSB PDB site
Description: human methylenetetrahydrofolate dehydrogenase / cyclohydrolase complexed with nadp and inhibitor ly374571
Class: oxidoreductase,hydrolase
Keywords: tetrahydrofolate, dehydrogenase, cyclohydrolase, nadp, inhibitor, rossmann fold, oxidoreductase,hydrolase
Deposited on 1999-11-29, released 2000-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylenetetrahydrofolate dehydrogenase / cyclohydrolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1diga1, d1diga2
  • Chain 'B':
    Compound: methylenetetrahydrofolate dehydrogenase / cyclohydrolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1digb1, d1digb2
  • Heterogens: ACT, NAP, L37, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1digA (A:)
    mapaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaa
    eeigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiap
    ekdvdgltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgap
    mhdlllwnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginy
    vpddkkpngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrflekfkp
    gkwmiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1digA (A:)
    apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
    eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
    kdvdgltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapm
    hdlllwnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyk
    vvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1digB (B:)
    mapaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaa
    eeigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiap
    ekdvdgltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgap
    mhdlllwnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginy
    vpddkkpngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrflekfkp
    gkwmiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1digB (B:)
    apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
    eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
    kdvdgltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapm
    hdlllwnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyv
    pddkkpngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle