PDB entry 1di7

View 1di7 on RCSB PDB site
Description: 1.60 angstrom crystal structure of the molybdenum cofactor biosynthesis protein moga from escherichia coli
Class: unknown function
Keywords: molybdenum cofactor, moco, moybdenum co-factor, mog, moga, gephyrin, unknown function
Deposited on 1999-11-29, released 2000-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.206
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: molybdenum cofactor biosynthetic enzyme
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28694
      • engineered (1)
    Domains in SCOPe 2.07: d1di7a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1di7A (A:)
    matlriglvsisdrassgvyqdkgipaleewltsalttpfeletrlipdeqaiieqtlce
    lvdemschlvlttggtgparrdvtpdatlavadrempgfgeqmrqislhfvptailsrqv
    gvirkqalilnlpgqpksiketlegvkdaegnvvvhgifasvpyciqllegpyvetapev
    vaafrpksarrdvse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1di7A (A:)
    atlriglvsisdryqdkgipaleewltsalttpfeletrlipdeqaiieqtlcelvdems
    chlvlttggtgparrdvtpdatlavadrempgfgeqmrqislhfvptailsrqvgvirkq
    alilnlpgqpksiketlegvkdaegnvvvhgifasvpyciqllegpyvetapevvaafrp
    ksarr