PDB entry 1di6

View 1di6 on RCSB PDB site
Description: 1.45 a crystal structure of the molybdenumm cofactor biosynthesis protein moga from escherichia coli
Class: unknown function
Keywords: molybdenum cofactor, moco, moco biosynthesis, moga, gephyrin
Deposited on 1999-11-29, released 2000-01-19
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.187
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: molybdenum cofactor biosythetic enzyme
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28694
      • engineered (1)
    Domains in SCOP 1.73: d1di6a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1di6A (A:)
    matlriglvsisdrassgvyqdkgipaleewltsalttpfeletrlipdeqaiieqtlce
    lvdemschlvlttggtgparrdvtpdatlavadrempgfgeqmrqislhfvptailsrqv
    gvirkqalilnlpgqpksiketlegvkdaegnvvvhgifasvpyciqllegpyvetapev
    vaafrpksarrdvse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1di6A (A:)
    atlriglvsisdrdkgipaleewltsalttpfeletrlipdeqaiieqtlcelvdemsch
    lvlttggtgparrdvtpdatlavadrempgfgeqmrqislhfvptailsrqvgvirkqal
    ilnlpgqpksiketlegvkdaegnvvvhgifasvpyciqllegpyvetapevvaafrpks
    arr