PDB entry 1di4

View 1di4 on RCSB PDB site
Description: role of amino acid residues at turns in the conformational stability and folding of human lysozyme
Deposited on 1999-11-29, released 1999-12-08
The last revision prior to the SCOP 1.69 freeze date was dated 2000-08-23, with a file datestamp of 2000-08-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1di4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1di4A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnyndrstdygifqinsr
    ywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrdvr
    qyvqgcgv