PDB entry 1di4

View 1di4 on RCSB PDB site
Description: role of amino acid residues at turns in the conformational stability and folding of human lysozyme
Class: hydrolase
Keywords: stability, turn, mutant, hydrolase
Deposited on 1999-11-29, released 1999-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lysozyme C
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61626 (0-127)
  Domains in SCOPe 2.08: d1di4a_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1di4A (A:)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnyndrstdygifqinsr
  ywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrdvr
  qyvqgcgv