PDB entry 1di2

View 1di2 on RCSB PDB site
Description: crystal structure of a dsRNA-binding domain complexed with dsRNA: molecular basis of double-stranded RNA-protein interactions
Class: RNA binding protein/RNA
Keywords: protein-RNA complex, double stranded RNA, protein-RNA interactions, RNA-bining protein, RNA binding protein/RNA complex
Deposited on 1999-11-28, released 1999-12-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.228
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: double stranded RNA binding protein a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91836 (0-68)
      • engineered (0)
    Domains in SCOPe 2.06: d1di2a_
  • Chain 'B':
    Compound: double stranded RNA binding protein a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91836 (0-68)
      • engineered (0)
    Domains in SCOPe 2.06: d1di2b_
  • Chain 'C':
    Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1di2A (A:)
    mpvgslqelavqkgwrlpeytvaqesgpphkreftitcrvetfvetgsgtskqvakrvaa
    eklltkfkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1di2B (B:)
    mpvgslqelavqkgwrlpeytvaqesgpphkreftitcrvetfvetgsgtskqvakrvaa
    eklltkfkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1di2B (B:)
    mpvgslqelavqkgwrlpeytvaqftitcrvetfvetgsgtskqvakrvaaeklltkfkt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    No sequence available.