PDB entry 1dhx

View 1dhx on RCSB PDB site
Description: the refined crystal structure of hexon, the major coat protein of adenovirus type 2, at 2.9 angstroms resolution
Deposited on 1995-06-06, released 1995-09-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.225
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1dhx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1dhx_ (-)
    frnptvapthdvttdrsqrltlrfipvdredtaysykarftlavgdnrvldmastyfdir
    gvldrgptfkpysgtaynalapkgapnsceweqtedsgravaedeeeededeeeeeeeqn
    ardqatkkthvyaqaplsgetitksglqigsdnaetqakpvyadpsyqpepqigesqwne
    adanaaggrvlkkttpmkpcygsyarptnpfggqsvlvpdekgvplpkvdlqffsnttsl
    ndrqgnatkpkvvlysedvnmetpdthlsykpgkgdenskamlgqqsmpnrpnyiafrdn
    figlmyynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavd
    sydpdvriienhgtedelpnycfplggigvtdtyqaikangngsgdngdttwtkdetfat
    rneigvgnnfameinlnanlwrnflysnialylpdklkynptnveisdnpntydymnkrv
    vapglvdcyinlgarwsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffa
    iknllllpgsytyewnfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntas
    tleamlrndtndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktket
    pslgsgydpyytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrs
    vdgegynvaqcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvdd
    tkykeyqqvgilhqhnnsgfvgylaptmregqaypanvpypligktavdsitqkkflcdr
    tlwripfssnfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrv
    hqphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dhx_ (-)
    frnptvapthdvttdrsqrltlrfipvdredtaysykarftlavgdnrvldmastyfdir
    gvldrgptfkpysgtaynalapkgapnsceweqtedsgravaedeeeededeeeeeeeqn
    ardqatkkthvyaqaplsgetitksglqigsdnaetqakpvyadpsyqpepqigesqwne
    adanaaggrvlkkttpmkpcygsyarptnpfggqsvlvpdekgvplpkvkpkvvlysedv
    nmetpdthlsykpgkgdenskamlgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagq
    asqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelp
    nycfplggigvtdtyqaikangngsgdngdttwtkdetfatrneigvgnnfameinlnan
    lwrnflysnialylpdklkynptnveisdnpntydymnkrvvapglvdcyinlgarwsld
    ymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrk
    dvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndyl
    saanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipy
    ldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwfl
    vqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykeyqqvgilhqhnnsg
    fvgylaptmregqaypanvpypligktavdsitqkkflcdrtlwripfssnfmsmgaltd
    lgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhqphrgvietvylrtpfsa
    gnatt