PDB entry 1dhx

View 1dhx on RCSB PDB site
Description: the refined crystal structure of hexon, the major coat protein of adenovirus type 2, at 2.9 angstroms resolution
Deposited on 1995-06-06, released 1995-09-15
The last revision was dated 2003-04-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.225
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenovirus type 2 hexon
    Species: ADENOVIRUS
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1dhxA (A:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnsceweqtedsgravaedeeeededeeeeeeeqnardqatkkthvyaqapl
    sgetitksglqigsdnaetqakpvyadpsyqpepqigesqwneadanaaggrvlkkttpm
    kpcygsyarptnpfggqsvlvpdekgvplpkvdlqffsnttslndrqgnatkpkvvlyse
    dvnmetpdthlsykpgkgdenskamlgqqsmpnrpnyiafrdnfiglmyynstgnmgvla
    gqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtede
    lpnycfplggigvtdtyqaikangngsgdngdttwtkdetfatrneigvgnnfameinln
    anlwrnflysnialylpdklkynptnveisdnpntydymnkrvvapglvdcyinlgarws
    ldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnf
    rkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtndqsfnd
    ylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsi
    pyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdw
    flvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykeyqqvgilhqhnn
    sgfvgylaptmregqaypanvpypligktavdsitqkkflcdrtlwripfssnfmsmgal
    tdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhqphrgvietvylrtpf
    sagnatt
    

    Sequence, based on observed residues (ATOM records):
    >1dhxA (A:)
    frnptvapthdvttdrsqrltlrfipvdredtaysykarftlavgdnrvldmastyfdir
    gvldrgptfkpysgtaynalapkgapnsceweqtedsgravaedeeeededeeeeeeeqn
    ardqatkkthvyaqaplsgetitksglqigsdnaetqakpvyadpsyqpepqigesqwne
    adanaaggrvlkkttpmkpcygsyarptnpfggqsvlvpdekgvplpkvkpkvvlysedv
    nmetpdthlsykpgkgdenskamlgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagq
    asqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelp
    nycfplggigvtdtyqaikangngsgdngdttwtkdetfatrneigvgnnfameinlnan
    lwrnflysnialylpdklkynptnveisdnpntydymnkrvvapglvdcyinlgarwsld
    ymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrk
    dvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndyl
    saanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipy
    ldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwfl
    vqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykeyqqvgilhqhnnsg
    fvgylaptmregqaypanvpypligktavdsitqkkflcdrtlwripfssnfmsmgaltd
    lgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhqphrgvietvylrtpfsa
    gnatt