PDB entry 1dhp

View 1dhp on RCSB PDB site
Description: dihydrodipicolinate synthase
Class: synthase
Keywords: synthase, dihydrodipicolinate
Deposited on 1995-02-09, released 1997-02-12
The last revision prior to the SCOP 1.75 freeze date was dated 1997-02-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodipicolinate synthase
    Species: ESCHERICHIA COLI
    Gene: dapA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dhpa_
  • Chain 'B':
    Compound: Dihydrodipicolinate synthase
    Species: ESCHERICHIA COLI
    Gene: dapA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dhpb_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dhpA (A:)
    mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
    mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
    aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
    fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
    nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dhpB (B:)
    mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
    mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
    aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
    fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
    nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll