PDB entry 1dhn

View 1dhn on RCSB PDB site
Description: 1.65 angstrom resolution structure of 7,8-dihydroneopterin aldolase from staphylococcus aureus
Deposited on 1998-03-31, released 1999-04-20
The last revision prior to the SCOP 1.71 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.197
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1dhn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dhn_ (-)
    mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
    vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
    k