PDB entry 1dhn

View 1dhn on RCSB PDB site
Description: 1.65 angstrom resolution structure of 7,8-dihydroneopterin aldolase from staphylococcus aureus
Class: pterin binding
Keywords: pterin binding, folate biosynthesis, antibiotic target, beta-barrel
Deposited on 1998-03-31, released 1999-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.197
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 7,8-dihydroneopterin aldolase
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: DHNA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56740 (0-120)
  Domains in SCOPe 2.08: d1dhna_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dhnA (A:)
  mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
  vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
  k