PDB entry 1dhn

View 1dhn on RCSB PDB site
Description: 1.65 angstrom resolution structure of 7,8-dihydroneopterin aldolase from staphylococcus aureus
Class: pterin binding
Keywords: pterin binding, folate biosynthesis, antibiotic target, beta-barrel
Deposited on 1998-03-31, released 1999-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.197
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydroneopterin aldolase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: DHNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dhna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dhnA (A:)
    mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
    vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
    k