PDB entry 1dhm

View 1dhm on RCSB PDB site
Description: DNA-binding domain of e2 from human papillomavirus-31, nmr, minimized average structure
Class: DNA-binding protein
Keywords: DNA-binding protein, transcriptional activator, early protein, trans-acting factor
Deposited on 1995-08-15, released 1996-12-07
The last revision prior to the SCOP 1.73 freeze date was dated 1996-12-07, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: e2 protein
  Species: Human papillomavirus
  Gene: E2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17383 (1-82)
  Domains in SCOP 1.73: d1dhma_
• Chain 'B':
  Compound: e2 protein
  Species: Human papillomavirus
  Gene: E2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17383 (1-82)
  Domains in SCOP 1.73: d1dhmb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dhmA (A:)
  mattpiihlkgdanilkclryrlskykqlyeqvsstwhwtctdgkhknaivtltyistsq
  rddflntvkipntvsvstgymti
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dhmB (B:)
  mattpiihlkgdanilkclryrlskykqlyeqvsstwhwtctdgkhknaivtltyistsq
  rddflntvkipntvsvstgymti