PDB entry 1dhm

View 1dhm on RCSB PDB site
Description: DNA-binding domain of e2 from human papillomavirus-31, nmr, minimized average structure
Class: DNA-binding protein
Keywords: DNA-binding protein, transcriptional activator, early protein, trans-acting factor
Deposited on 1995-08-15, released 1996-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e2 protein
    Species: Human papillomavirus - 16 [TaxId:10585]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dhma_
  • Chain 'B':
    Compound: e2 protein
    Species: Human papillomavirus - 16 [TaxId:10585]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dhmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dhmA (A:)
    mattpiihlkgdanilkclryrlskykqlyeqvsstwhwtctdgkhknaivtltyistsq
    rddflntvkipntvsvstgymti
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dhmB (B:)
    mattpiihlkgdanilkclryrlskykqlyeqvsstwhwtctdgkhknaivtltyistsq
    rddflntvkipntvsvstgymti