PDB entry 1dhk

View 1dhk on RCSB PDB site
Description: structure of porcine pancreatic alpha-amylase
Deposited on 1996-10-14, released 1997-12-24
The last revision prior to the SCOP 1.63 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.183
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dhkA (A:)
    eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenvvvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiqsseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggasiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgqpfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dhkB (B:)
    atetsfiidafnktnlilqgdatvssngnlqlsynsydsmsrafysapiqirdsttgnva
    sfdtnftmnirthrqansavgldfvlvpvqpeskgdtvtvefdtflsrisidvnnndiks
    vpwdvhdydgqnaevritynsstkvfsvslsnpstgksnnvsttvelekevydwvsvgfs
    atsgayqwsyethdvlswsfsskf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dhkB (B:)
    atetsfiidafnktnlilqgdatvssngnlqlsynsydsmsrafysapiqirdsttgnva
    sfdtnftmnirthrsavgldfvlvpvdtvtvefdtflsrisidvnnndiksvpwdvhdyd
    gqnaevritynsstkvfsvslsnpstgksnnvsttvelekevydwvsvgfsatsgayqws
    yethdvlswsfsskf