PDB entry 1dhk

View 1dhk on RCSB PDB site
Description: structure of porcine pancreatic alpha-amylase
Class: complex (hydrolase/inhibitor)
Keywords: PANCREATIC ALPHA-AMYLASE, PORCINE, LECTIN-LIKE INHIBITOR, COMPLEX (HYDROLASE-INHIBITOR), COMPLEX (HYDROLASE-INHIBITOR) complex
Deposited on 1996-10-14, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.183
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: porcine pancreatic alpha-amylase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00690 (1-495)
      • conflict (48)
      • conflict (403)
    Domains in SCOPe 2.07: d1dhka1, d1dhka2
  • Chain 'B':
    Compound: bean lectin-like inhibitor
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dhkb_
  • Heterogens: NAG, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dhkA (A:)
    eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenvvvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiqsseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggasiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgqpfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dhkB (B:)
    atetsfiidafnktnlilqgdatvssngnlqlsynsydsmsrafysapiqirdsttgnva
    sfdtnftmnirthrqansavgldfvlvpvqpeskgdtvtvefdtflsrisidvnnndiks
    vpwdvhdydgqnaevritynsstkvfsvslsnpstgksnnvsttvelekevydwvsvgfs
    atsgayqwsyethdvlswsfsskfinlkdqksersnivlnkil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dhkB (B:)
    atetsfiidafnktnlilqgdatvssngnlqlsynsydsmsrafysapiqirdsttgnva
    sfdtnftmnirthrsavgldfvlvpvdtvtvefdtflsrisidvnnndiksvpwdvhdyd
    gqnaevritynsstkvfsvslsnpstgksnnvsttvelekevydwvsvgfsatsgayqws
    yethdvlswsfsskf