PDB entry 1dhg

View 1dhg on RCSB PDB site
Description: hg-substituted desulforedoxin
Deposited on 1999-03-22, released 1999-07-09
The last revision prior to the SCOP 1.59 freeze date was dated 2001-09-26, with a file datestamp of 2001-09-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1dhga_
  • Chain 'B':
    Domains in SCOP 1.59: d1dhgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dhgA (A:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dhgB (B:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq