PDB entry 1dh2

View 1dh2 on RCSB PDB site
Description: structure of apo t. gondii adenosine kinase
Class: transferase
Keywords: alpha-beta structure
Deposited on 1999-11-27, released 2000-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2002-06-12, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase apo form
    Species: Toxoplasma gondii
    Database cross-references and differences (RAF-indexed):
    • GB AF128274
      • conflict (50)
      • conflict (125)
      • conflict (149)
      • conflict (239)
      • conflict (326)
      • conflict (340)
    Domains in SCOPe 2.07: d1dh2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dh2A (A:)
    mavdssnsatgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldq
    fnptslpggsalnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvap
    gqstgtcavlinekertlcthlgacgsfripedwttfasgalifyataytltatpknale
    vagyahgipnaiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaad
    ktalstankehavevctgalrlltagqntgatklvvmtrghnpviaaeqtadgtvvvhev
    gvpvvaaekivdtngagdafvggflyglsqgktvkqcimcgnacaqdviqhvgfslsfts
    lpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dh2A (A:)
    pmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpggsa
    lnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgtcavli
    nekertlcthlgacgsfripedwttfasgalifyataytltatpknalevagyahgipna
    iftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaadktalstankeh
    avegatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaekivdtngagdafvggfly
    glsqgktvkqcimcgnacaqdviqhvgfsl