PDB entry 1dh0

View 1dh0 on RCSB PDB site
Description: structure of t. gondii adenosine kinase bound to adenosine
Class: transferase
Keywords: alpha-beta structure
Deposited on 1999-11-27, released 2000-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2002-05-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.15
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Toxoplasma gondii
    Database cross-references and differences (RAF-indexed):
    • GB AF128274
      • conflict (124)
      • conflict (138)
      • conflict (141)
      • conflict (241)
      • conflict (245)
      • conflict (326)
    Domains in SCOPe 2.07: d1dh0a_
  • Heterogens: SO4, CL, ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dh0A (A:)
    mavdssnsatgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldq
    fnptslpggsalnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvap
    gqstgtcavlinekertlcthlgacgsfripenwttfasgalifyataytltatpknale
    vagyahgipnaiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaae
    kvalsvankehavevctgalrlltagqntgatklvvmtrghnpviaaeqtadgtvvvhev
    gvpvvaaekivdtngagdafvggflyglsqgktvkqcimcgnacaqdviqhvgfslsfts
    lpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dh0A (A:)
    gpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpggs
    alnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgtcavl
    inekertlcthlgacgsfripenwttfasgalifyataytltatpknalevagyahgipn
    aiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaaekvalsvanke
    havtgatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaekivdtngagdafvggfl
    yglsqgktvkqcimcgnacaqdviqhvgfslsf