PDB entry 1dgy

View 1dgy on RCSB PDB site
Description: structure of t. gondii adenosine kinase bound to adenosine 2 and amp-pcp
Deposited on 1999-11-26, released 2000-03-20
The last revision was dated 2002-05-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.187
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Toxoplasma gondii
    Database cross-references and differences (RAF-indexed):
    • GB AF128274
      • conflict (124)
      • conflict (138)
      • conflict (141)
      • conflict (241)
      • conflict (245)
      • conflict (326)
  • Heterogens: MG, CL, ADN, ACP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1dgyA (A:)
    mavdssnsatgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldq
    fnptslpggsalnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvap
    gqstgtcavlinekertlcthlgacgsfripenwttfasgalifyataytltatpknale
    vagyahgipnaiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaae
    kvalsvankehavevctgalrlltagqntgatklvvmtrghnpviaaeqtadgtvvvhev
    gvpvvaaekivdtngagdafvggflyglsqgktvkqcimcgnacaqdviqhvgfslsfts
    lpc
    

    Sequence, based on observed residues (ATOM records):
    >1dgyA (A:)
    gpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpggs
    alnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgtcavl
    inekertlcthlgacgsfripenwttfasgalifyataytltatpknalevagyahgipn
    aiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaaekvalsvanke
    havegatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaekivdtngagdafvggfl
    yglsqgktvkqcimcgnacaqdviqhvgfslsf