PDB entry 1dgv

View 1dgv on RCSB PDB site
Description: homology-based model of apo cib (calcium-and integrin-binding protein)
Class: blood clotting
Keywords: helical, ef-hand, blood clotting
Deposited on 1999-11-25, released 1999-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apo cib
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99828 (0-182)
      • conflict (35)
    Domains in SCOPe 2.06: d1dgva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgvA (A:)
    skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
    fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
    srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
    ivl