PDB entry 1dgu

View 1dgu on RCSB PDB site
Description: homology-based model of calcium-saturated cib (calcium-and integrin-binding protein)
Class: blood clotting
Keywords: helical, ef-hands, blood clotting
Deposited on 1999-11-25, released 1999-12-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calcium-saturated cib
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99828 (0-182)
    • conflict (35)
  Domains in SCOPe 2.01: d1dgua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dguA (A:)
  skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
  fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
  srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
  ivl