PDB entry 1dgu

View 1dgu on RCSB PDB site
Description: homology-based model of calcium-saturated cib (calcium-and integrin-binding protein)
Deposited on 1999-11-25, released 1999-12-08
The last revision prior to the SCOP 1.71 freeze date was dated 2000-08-30, with a file datestamp of 2000-08-30.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1dgua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dguA (A:)
    skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
    fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
    srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
    ivl