PDB entry 1dgt

View 1dgt on RCSB PDB site
Description: crystal structure of nad+-dependent DNA ligase
Class: ligase
Keywords: amp complex, nad+-dependent
Deposited on 1999-11-25, released 2000-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-03-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.254
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA ligase
    Species: Thermus filiformis
    Database cross-references and differences (RAF-indexed):
    • GB AF061572
    Domains in SCOPe 2.07: d1dgta4, d1dgta5, d1dgta6
  • Chain 'B':
    Compound: DNA ligase
    Species: Thermus filiformis
    Database cross-references and differences (RAF-indexed):
    • GB AF061572 (0-End)
  • Heterogens: ZN, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dgtA (A:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
    svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
    neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
    llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
    taraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnes
    yieeldirigdwvlvhkaggvipevlrvlkerrtgkerpirwpeacpecghrlvkegkvh
    rcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedllgl
    ermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleaslee
    lieveevgeltarailetlkdpafrdlvrrlkeagvsmeskeevsdllsgltfvltgels
    rpreevkallgrlgakvtdsvsrktsylvvgenpgsklekaralgvavlteeefwrflke
    kgapvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgtA (A:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
    svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
    neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
    llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
    taraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnes
    yieeldirigdwvlvhkaggvipevlrvlkerrtgkerpirwpeacpecghrlvkegkvh
    rcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedllgl
    ermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleaslee
    lieveevgeltarailetlkdpafrdlvrrlkeagvsmesk
    

  • Chain 'B':
    No sequence available.