PDB entry 1dgs

View 1dgs on RCSB PDB site
Description: crystal structure of nad+-dependent DNA ligase from t. filiformis
Class: ligase
Keywords: amp complex, nad+-dependent, ligase
Deposited on 1999-11-25, released 2000-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.228
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA ligase
    Species: Thermus filiformis [TaxId:276]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dgsa1, d1dgsa2, d1dgsa3
  • Chain 'B':
    Compound: DNA ligase
    Species: Thermus filiformis [TaxId:276]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dgsb1, d1dgsb2, d1dgsb3
  • Heterogens: ZN, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dgsA (A:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
    svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
    neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
    llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
    taraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnes
    yieeldirigdwvlvhkaggvipevlrvlkerrtgkerpirwpeacpecghrlvkegkvh
    rcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedllgl
    ermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleaslee
    lieveevgeltarailetlkdpafrdlvrrlkeagvsmeskeevsdllsgltfvltgels
    rpreevkallgrlgakvtdsvsrktsylvvgenpgsklekaralgvavlteeefwrflke
    kgapvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgsA (A:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
    svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
    neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
    llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
    taraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnes
    yieeldirigdwvlvhkaggvipevlrvlkerrtgkerpirwpeacpecghrlvkegkvh
    rcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedllgl
    ermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleaslee
    lieveevgeltarailetlkdpafrdlvrrlkeagvsmesk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dgsB (B:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
    svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
    neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
    llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
    taraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnes
    yieeldirigdwvlvhkaggvipevlrvlkerrtgkerpirwpeacpecghrlvkegkvh
    rcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedllgl
    ermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleaslee
    lieveevgeltarailetlkdpafrdlvrrlkeagvsmeskeevsdllsgltfvltgels
    rpreevkallgrlgakvtdsvsrktsylvvgenpgsklekaralgvavlteeefwrflke
    kgapvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgsB (B:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
    svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
    neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
    llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
    taraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnes
    yieeldirigdwvlvhkaggvipevlrvlkerrtgkerpirwpeacpecghrlvkegkvh
    rcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedllgl
    ermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleaslee
    lieveevgeltarailetlkdpafrdlvrrlkeagvsmesk