PDB entry 1dgr

View 1dgr on RCSB PDB site
Description: Refined crystal structure of canavalin from jack bean
Deposited on 1999-11-25, released 1999-12-20
The last revision prior to the SCOP 1.71 freeze date was dated 1999-12-20, with a file datestamp of 1999-12-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.18
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1dgra_
  • Chain 'B':
    Domains in SCOP 1.71: d1dgrb_
  • Chain 'C':
    Domains in SCOP 1.71: d1dgrc_
  • Chain 'M':
    Domains in SCOP 1.71: d1dgr.3
  • Chain 'N':
    Domains in SCOP 1.71: d1dgr.3
  • Chain 'V':
    Domains in SCOP 1.71: d1dgr.2
  • Chain 'W':
    Domains in SCOP 1.71: d1dgr.2
  • Chain 'X':
    Domains in SCOP 1.71: d1dgr.1
  • Chain 'Y':
    Domains in SCOP 1.71: d1dgr.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgrA (A:)
    nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
    sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
    frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgrB (B:)
    nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
    sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
    frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgrC (C:)
    nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
    sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
    frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1dgrM (M:)
    mqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaennernflaghkenvirqi
    prqvsdltfpgsgeeveellenqkesyfvdgqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgrM (M:)
    qlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaennernflaghkenvirqip
    rqvsdltfpgsgeeveellenqkesyfvdgqp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1dgrN (N:)
    dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
    lvanegraevelvgleqqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgrN (N:)
    dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
    lvanegraevelvgle
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1dgrV (V:)
    dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
    lvanegraevelvgleqqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgrV (V:)
    dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
    lvanegraevelvgle
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgrW (W:)
    mqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaennernflaghkenvirqi
    prqvsdltfpgsgeeveellenqkesyfvdgqp
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1dgrX (X:)
    dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
    lvanegraevelvgleqqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgrX (X:)
    dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
    lvanegraevelvgl
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgrY (Y:)
    mqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaennernflaghkenvirqi
    prqvsdltfpgsgeeveellenqkesyfvdgqp