PDB entry 1dgq

View 1dgq on RCSB PDB site
Description: nmr solution structure of the inserted domain of human leukocyte function associated antigen-1
Deposited on 1999-11-24, released 2000-02-03
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-03, with a file datestamp of 2000-02-03.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dgqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgqA (A:)
    maskgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdf
    sdyvkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeat
    dsgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelq
    kkiyvieg