PDB entry 1dgq

View 1dgq on RCSB PDB site
Description: nmr solution structure of the inserted domain of human leukocyte function associated antigen-1
Class: immune system
Keywords: rossmann fold, immune system
Deposited on 1999-11-24, released 2000-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: leukocyte function associated antigen-1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20701 (0-187)
    • conflict (0-2)
    • conflict (65)
  Domains in SCOPe 2.08: d1dgqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dgqA (A:)
  maskgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdf
  sdyvkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeat
  dsgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelq
  kkiyvieg