PDB entry 1dgp

View 1dgp on RCSB PDB site
Description: aristolochene synthase farnesol complex
Class: lyase
Keywords: sesquiterpene cyclase, isoprenoid biosynthesis, lyase
Deposited on 1999-11-24, released 2001-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aristolochene synthase
    Species: Penicillium roqueforti [TaxId:5082]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dgpa_
  • Chain 'B':
    Compound: Aristolochene synthase
    Species: Penicillium roqueforti [TaxId:5082]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dgpb_
  • Heterogens: FOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dgpA (A:)
    tppptqwsylchprvkevqdevdgyflenwkfpsfkavrtfldakfsevtclyfplaldd
    rihfacrlltvlfliddvlehmsfadgeaynnrlipisrgdvlpdrtkpeefilydlwes
    mrahdaelanevleptfvfmraqtdrarlsihelghyleyrekdvgkallsalmrfsmgl
    rlsadelqdmkaleancakqlsvvndiysydkeeeasrtghkegaflcsavkvlaeeskl
    gipatkrvlwsmtrewetvhdeivaekiaspdgcseaakaymkgleyqmsgneqwskttr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgpA (A:)
    tppptqwsylchprvkevqdevdgyflenwkfpsfkavrtfldakfsevtclyfplaldd
    rihfacrlltvlfliddvlehmsfadgeaynnrlipisrgdvlpdrtkpeefilydlwes
    mrahdaelanevleptfvfmraqtdrarlsihelghyleyrekdvgkallsalmrfsmgl
    rlsadelqdmkaleancakqlsvvndiysydkeeealcsavkvlaeesklgipatkrvlw
    smtrewetvhdeivaekiaspdgcseaakaymkgleyqmsgneqwskttr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dgpB (B:)
    tppptqwsylchprvkevqdevdgyflenwkfpsfkavrtfldakfsevtclyfplaldd
    rihfacrlltvlfliddvlehmsfadgeaynnrlipisrgdvlpdrtkpeefilydlwes
    mrahdaelanevleptfvfmraqtdrarlsihelghyleyrekdvgkallsalmrfsmgl
    rlsadelqdmkaleancakqlsvvndiysydkeeeasrtghkegaflcsavkvlaeeskl
    gipatkrvlwsmtrewetvhdeivaekiaspdgcseaakaymkgleyqmsgneqwskttr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgpB (B:)
    tppptqwsylchprvkevqdevdgyflenwkfpsfkavrtfldakfsevtclyfplaldd
    rihfacrlltvlfliddvlehmsfadgeaynnrlipisrgdvlpdrtkpeefilydlwes
    mrahdaelanevleptfvfmraqtdrarlsihelghyleyrekdvgkallsalmrfsmgl
    rlsadelqdmkaleancakqlsvvndiysydkeeealcsavkvlaeesklgipatkrvlw
    smtrewetvhdeivaekiaspdgcseaakaymkgleyqmsgneqwskttr