PDB entry 1dgn

View 1dgn on RCSB PDB site
Description: solution structure of iceberg, an inhibitor of interleukin-1beta generation
Class: hydrolase inhibitor
Keywords: antiparallel six-helix bundle, greek-key, hydrolase inhibitor
Deposited on 1999-11-24, released 2000-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iceberg (protease inhibitor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dgna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgnA (A:)
    adqllrkkrrifihsvgagtinalldclledevisqedmnkvrdendtvmdkarvlidlv
    tgkgpkscckfikhlceedpqlaskmglh