PDB entry 1dgm

View 1dgm on RCSB PDB site
Description: crystal structure of adenosine kinase from toxoplasma gondii
Deposited on 1999-11-24, released 2000-11-29
The last revision prior to the SCOP 1.71 freeze date was dated 2000-11-29, with a file datestamp of 2000-11-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1dgma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dgmA (A:)
    mavdssnsatgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldq
    fnptslpggsalnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvap
    gqstgvcavlinekertlcthlgacgsfrlpedwttfasgalifyataytltatpknafe
    vagyahgipnaiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvaae
    ktalstankehavevctgalrlltagqntgatklvvmtrghnpviaaeqtadgtvvvhev
    gvpvvaaekivdtngagdafvggflyalsqgktvkqcimcgnacaqdviqhvgfslsfts
    lpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgmA (A:)
    tgpmrvfaignpildlvaevpssfldefflkrgdatlatpeqmriystldqfnptslpgg
    salnsvrvvqkllrkpgsagymgaigddprgqvlkelcdkeglatrfmvapgqstgvcav
    linekertlcthlgacgsfrlpedwttfasgalifyataytltatpknafevagyahgip
    naiftlnlsapfcvelykdamqslllhtnilfgneeefahlakvhnlvtankehavevct
    galrlltagqntgatklvvmtrghnpviaaeqtadgtvvvhevgvpvvaaekivdtngag
    dafvggflyalsqgktvkqcimcgnacaqdviqhvgfslsftslpc